PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29635.m000468
Common NameLOC8283442, RCOM_0538580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 510aa    MW: 55693.9 Da    PI: 7.8043
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29635.m000468genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.65.3e-33224280259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    dDgynWrKYGqK++kgse+prsYY+Ct+ +Cpvkkkvers+ d++++ei+Y+g H he
  29635.m000468 224 DDGYNWRKYGQKPIKGSEYPRSYYKCTHLNCPVKKKVERSS-DGQITEIIYKGLHSHE 280
                    8****************************************.***************8 PP

2WRKY106.61.3e-33400458159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK vkg+++prsYY+CtsagC+v+k+ver+a dpk+v++tYeg+Hnh+
  29635.m000468 400 LDDGYRWRKYGQKLVKGNPHPRSYYKCTSAGCNVRKHVERAAADPKAVVTTYEGKHNHD 458
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.858218282IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-29220283IPR003657WRKY domain
SuperFamilySSF1182903.01E-26222282IPR003657WRKY domain
SMARTSM007741.5E-37223281IPR003657WRKY domain
PfamPF031061.9E-25224279IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-36385460IPR003657WRKY domain
SuperFamilySSF1182902.35E-29392460IPR003657WRKY domain
PROSITE profilePS5081138.366395460IPR003657WRKY domain
SMARTSM007741.2E-39400459IPR003657WRKY domain
PfamPF031062.7E-26401458IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MAAEKQAPPR PTITLPPRPS MDTLFTGGLS PGPMTLVSSF FSDNYLDSDS RSFSQLLAGA  60
MASPIARPSF FTDASSNKQD GLDNSANLGF KQSRPMNLVV AHHSPLFTVP PGLSPSGLLN  120
SPGFFSPPQS PFGMSHQQAL AQVTAQAALA AQNHMHLQAQ YQPAPVSAST ELLTRQPSFT  180
PGEASQLQML PSTSEPHNSM VEASDLSHSD RKQQPPLAVD KPSDDGYNWR KYGQKPIKGS  240
EYPRSYYKCT HLNCPVKKKV ERSSDGQITE IIYKGLHSHE QPQPNKRAKD SSDQNGSTSS  300
QAKPEPGSLS QAGNINKSNE TFPAHSVHGM EQEPTQANTE LPGSSDSEEA GEMRAEDGNE  360
DEPNPKRRQT DVGTSEVALP HKTVTEPKII VQTRSEVDLL DDGYRWRKYG QKLVKGNPHP  420
RSYYKCTSAG CNVRKHVERA AADPKAVVTT YEGKHNHDVP AARNSSHNTA NNSALQLKPQ  480
KVVAEKHPFL FGNNDKRPVL LQLKEEEIAV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-40224461878Probable WRKY transcription factor 4
2lex_A1e-40224461878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015581380.10.0PREDICTED: probable WRKY transcription factor 4
SwissprotQ9ZQ701e-146WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLB9SVK50.0B9SVK5_RICCO; WRKY transcription factor, putative
STRINGVIT_14s0108g01280.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-119WRKY DNA-binding protein 3